PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10026472m
Common NameCICLE_v10026472mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family DBB
Protein Properties Length: 214aa    MW: 24009.9 Da    PI: 8.0221
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10026472mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.9e-07433534
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeH 34
                      C+ +e   ++lfC  ++  lC++C l+ H
  Ciclev10026472m  4 LCDVCEATAATLFCPADEAALCASCDLKVH 33
                     7******99******************999 PP

2zf-B_box24.36.3e-086598538
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkgHt 38
                     kC++++++++ lfCe+ ++++C +C +  H gH 
  Ciclev10026472m 65 KCDLCDREKAFLFCEKGGMCICLTCDMVFHIGHP 98
                     8*****************************8896 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.741149IPR000315B-box-type zinc finger
CDDcd000213.43E-6333No hitNo description
PfamPF006432.4E-5334IPR000315B-box-type zinc finger
SMARTSM003360.083438IPR000315B-box-type zinc finger
SuperFamilySSF578458.06E-659101No hitNo description
SMARTSM003361.8E-661102IPR000315B-box-type zinc finger
PROSITE profilePS501198.88761102IPR000315B-box-type zinc finger
PfamPF006439.5E-76498IPR000315B-box-type zinc finger
CDDcd000219.54E-765102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MQILCDVCEA TAATLFCPAD EAALCASCDL KVHELAPFYD YKEHMNNKLA SSHVRHDLPP  60
SSFGKCDLCD REKAFLFCEK GGMCICLTCD MVFHIGHPRF LVMSQKIQFP VEDPIWGKPI  120
SRPLNQAEIK KEQNDPLEMT IGEDQQNHKV FPTAVADVRA TSKAKRGNKM IDLNRKPRNP  180
KAAAPKYKKK QTIDLKALLA LECQTSNHHL QFP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.209960.0flower
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425537.11e-159hypothetical protein CICLE_v10026472mg
RefseqXP_006466910.11e-159PREDICTED: B-box zinc finger protein 19-like isoform X1
TrEMBLV4SDZ71e-159V4SDZ7_9R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21320.15e-32DBB family protein